- Recombinant Escherichia coli Phosphatidylglycerophosphatase A (pgpA)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1016459
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 19,418 Da
- E Coli or Yeast
- Phosphatidylglycerophosphatase A (pgpA)
- 1-172
- JW0408, ECK0412, yajN
Sequence
MTILPRHKDVAKSRLKMSNPWHLLAVGFGSGLSPIVPGTMGSLAAIPFWYLMTFLPWQLYSLVVMLGICIGVYLCHQTAKDMGVHDHGSIVWDEFIGMWITLMALPTNDWQWVAAGFVIFRILDMWKPWPIRWFDRNVHGGMGIMIDDIVAGVISAGILYFIGHHWPLGILS